PDB entry 1sh4

View 1sh4 on RCSB PDB site
Description: Solution structure of oxidized bovine microsomal cytochrome B5 Mutant V45H
Class: electron transport
Keywords: five helix, five sheet, heme ring, electron transport
Deposited on 2004-02-25, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cytochrome b5
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00171 (0-81)
    • engineered (42)
  Domains in SCOPe 2.07: d1sh4a_
• Heterogens: HEM

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sh4A (A:)
  avkyytleeiqkhnnskstwlilhykvydltkfleehpggeehlreqaggdatenfedvg
  hstdarelsktfiigelhpddr