PDB entry 1sgy
View 1sgy on RCSB PDB site
Description: tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Class: hydrolase/hydrolase inhibitor
Keywords: complex (serine protease/inhibitor), serine proteinase, protein inhibitor, hydrolase/hydrolase inhibitor complex
Deposited on
1999-03-25, released
2003-08-26
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.52
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'E':
Compound: Streptogrisin B
Species: Streptomyces griseus [TaxId:1911]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1sgye_ - Chain 'I':
Compound: Ovomucoid
Species: Meleagris gallopavo [TaxId:9103]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d1sgyi_ - Heterogens: PO4, HOH
PDB Chain Sequences:
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>1sgyE (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy
- Chain 'I':
Sequence; same for both SEQRES and ATOM records: (download)
>1sgyI (I:)
vdcseypkpactyeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc