PDB entry 1sgy

View 1sgy on RCSB PDB site
Description: tyr 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Class: hydrolase/hydrolase inhibitor
Keywords: complex (serine protease/inhibitor), serine proteinase, protein inhibitor
Deposited on 1999-03-25, released 2003-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Streptogrisin B
    Species: Streptomyces griseus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sgye_
  • Chain 'I':
    Compound: Ovomucoid
    Species: Meleagris gallopavo
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered mutation (12)
    Domains in SCOP 1.73: d1sgyi_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sgyE (E:)
    isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
    nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
    gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
    gvsvy
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sgyI (I:)
    vdcseypkpactyeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc