PDB entry 1sgw

View 1sgw on RCSB PDB site
Description: Putative ABC transporter (ATP-binding protein) from Pyrococcus furiosus Pfu-867808-001
Class: transport protein
Keywords: Structural genomics, pyrococcus furiosus, ABC transporter, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, TRANSPORT PROTEIN
Deposited on 2004-02-24, released 2004-08-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ABC transporter
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U2E3 (9-End)
      • cloning artifact (8)
    Domains in SCOPe 2.08: d1sgwa1, d1sgwa2
  • Heterogens: CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgwA (A:)
    ahhhhhhgskleirdlsvgydkpvleritmtiekgnvvnfhgpngigkttllktistylk
    plkgeiiyngvpitkvkgkifflpeeiivprkisvedylkavaslygvkvnkneimdale
    svevldlkkklgelsqgtirrvqlastllvnaeiyvlddpvvaidedskhkvlksileil
    kekgiviissreelsycdvnenlhkystkidkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgwA (A:)
    skleirdlsvgydkpvleritmtiekgnvvnfhgpngigkttllktistylkplkgeiiy
    ngvpitkvkgkifflpeeiivprkisvedylkavaslygvkvnkneimdalesvevldlk
    kklgelsqgtirrvqlastllvnaeiyvlddpvvaidedskhkvlksileilkekgivii
    ssreelsycdvnenlhkyst