PDB entry 1sgv

View 1sgv on RCSB PDB site
Description: structure of trna psi55 pseudouridine synthase (trub)
Deposited on 2004-02-24, released 2004-03-02
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgvA (A:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgvA (A:)
    atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl
    ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeilearpiri
    drfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfeld
    qarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacdad
    grviallrdegsrtrsvavlrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgvB (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgvB (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrsvqlearpi
    ridrfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfe
    ldqarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacd
    adgrviallrdegsrtrsvavlrpat