PDB entry 1sgv

View 1sgv on RCSB PDB site
Description: structure of tRNA psi55 pseudouridine synthase (trub)
Class: lyase
Keywords: Hinged motion, tRNA modification, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, LYASE
Deposited on 2004-02-24, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA pseudouridine synthase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: TRUB, RV2793C, MT2862.1, MTV002.58C, MB2816C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgva1, d1sgva2
  • Chain 'B':
    Compound: tRNA pseudouridine synthase B
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: TRUB, RV2793C, MT2862.1, MTV002.58C, MB2816C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgvb1, d1sgvb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgvA (A:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgvA (A:)
    atgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkilgl
    ltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeilearpiri
    drfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfeld
    qarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacdad
    grviallrdegsrtrsvavlrp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgvB (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrgeirqvpss
    vsaikvggrrayrlarqgrsvqlearpiridrfellaarrrdqlididveidcssgtyir
    alardlgdalgvgghvtalrrtrvgrfeldqarslddlaerpalslsldeacllmfarrd
    ltaaeasaaangrslpavgidgvyaacdadgrviallrdegsrtrsvavlrpatmhpggv
    prgklaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgvB (B:)
    msatgpgivvidkpagmtshdvvgrcrrifatrrvghagtldpmatgvlvigieratkil
    glltaapksyaatirlgqttstedaegqvlqsvpakhltieaidaamerlrsvqlearpi
    ridrfellaarrrdqlididveidcssgtyiralardlgdalgvgghvtalrrtrvgrfe
    ldqarslddlaerpalslsldeacllmfarrdltaaeasaaangrslpavgidgvyaacd
    adgrviallrdegsrtrsvavlrpat