PDB entry 1sgu

View 1sgu on RCSB PDB site
Description: comparing the accumulation of active site and non-active site mutations in the hiv-1 protease
Deposited on 2004-02-24, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.22
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1sgua_
  • Chain 'B':
    Domains in SCOP 1.71: d1sgub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sguA (A:)
pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
qipieicghkvigtvlvgptpanvigrnlmtqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sguB (B:)
pqitlwqrplvtikiggqlrealldtgaddtifeeislpgrwkpkmiggiggfvkvrqyd
qipieicghkvigtvlvgptpanvigrnlmtqigctlnf