PDB entry 1sgo

View 1sgo on RCSB PDB site
Description: nmr structure of the human c14orf129 gene product, hspc210. northeast structural genomics target hr969.
Deposited on 2004-02-24, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.67: d1sgoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sgoA (A:)
  metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlfavnnmfvskslrca
  ddvayinvetkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayre
  afgnallqrlealkrdgqs