PDB entry 1sgo

View 1sgo on RCSB PDB site
Description: NMR Structure of the human C14orf129 gene product, HSPC210. Northeast Structural Genomics target HR969.
Class: structural genomics, unknown function
Keywords: HR969, NMR STRUCTURE, HUMAN PROTEIN, NESG, STRUCTURAL GENOMICS, Hs.4104 homo sapiens, NESG cluster ID 18152., PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-02-24, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Protein C14orf129
  Species: Homo sapiens [TaxId:9606]
  Gene: C14ORF129
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9P0R6 (0-138)
  Domains in SCOPe 2.08: d1sgoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sgoA (A:)
  metdcnpmelssmsgfeegselngfegtdmkdmrleaeavvndvlfavnnmfvskslrca
  ddvayinvetkernryclelteaglkvvgyafdqvddhlqtpyhetvyslldtlspayre
  afgnallqrlealkrdgqs