PDB entry 1sgm

View 1sgm on RCSB PDB site
Description: Crystal Structure of Hypothetical Protein YXAF
Class: transcription
Keywords: TRANSCRIPTION, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2004-02-24, released 2004-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-11-21, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative HTH-type transcriptional regulator yxaF
    Species: Bacillus subtilis
    Gene: YXAF, S14F, BSU39990
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sgma1, d1sgma2
  • Chain 'B':
    Compound: Putative HTH-type transcriptional regulator yxaF
    Species: Bacillus subtilis
    Gene: YXAF, S14F, BSU39990
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sgmb1, d1sgmb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgmA (A:)
    mtsrgdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavt
    ytgkivehliqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetalisepl
    rtvcmkvfksweavfarklmengfaeeeanqlgtlinsmieggimlsltnkdktplllia
    eqipvlvrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgmA (A:)
    gdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgk
    ivehliqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvc
    mkvfksweavfarklmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqip
    vlvr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgmB (B:)
    mtsrgdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavt
    ytgkivehliqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetalisepl
    rtvcmkvfksweavfarklmengfaeeeanqlgtlinsmieggimlsltnkdktplllia
    eqipvlvrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgmB (B:)
    gdsrekilhtasrlsqlqgyhatglnqivkesgapkgslyhffpngkeelaieavtytgk
    ivehliqqsmdessdpveaiqlfikktasqfdntesikgipvgllasetaliseplrtvc
    mkvfksweavfarklmengfaeeeanqlgtlinsmieggimlsltnkdktpllliaeqip
    vlvr