PDB entry 1sgj

View 1sgj on RCSB PDB site
Description: Crystal structure of citrate lyase beta subunit
Class: lyase
Keywords: citrate lyase beta subunit, trimer, TIM barrel, Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2004-02-23, released 2004-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.227
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sgja_
  • Chain 'B':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans
    Database cross-references and differences (RAF-indexed):
  • Heterogens: OAA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgjA (A:)
    mnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaar
    dliaaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqersl
    plpilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqval
    aarltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfgpteadr
    araralldaaaaaaqrghgafsfegqmvdepmlakartllshea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgjA (A:)
    ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
    aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
    ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
    ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.