PDB entry 1sgj

View 1sgj on RCSB PDB site
Description: Crystal structure of citrate lyase beta subunit
Class: lyase
Keywords: citrate lyase beta subunit, trimer, TIM barrel, Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2004-02-23, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.227
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgja_
  • Chain 'B':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgjb_
  • Chain 'C':
    Compound: citrate lyase, beta subunit
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgjc_
  • Heterogens: OAA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgjA (A:)
    mnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaar
    dliaaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqersl
    plpilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqval
    aarltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfgpteadr
    araralldaaaaaaqrghgafsfegqmvdepmlakartllshea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgjA (A:)
    ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
    aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
    ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
    ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgjB (B:)
    mnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaar
    dliaaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqersl
    plpilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqval
    aarltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfgpteadr
    araralldaaaaaaqrghgafsfegqmvdepmlakartllshea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgjB (B:)
    ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
    aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
    ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
    ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sgjC (C:)
    mnappallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaar
    dliaaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqersl
    plpilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqval
    aarltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfgpteadr
    araralldaaaaaaqrghgafsfegqmvdepmlakartllshea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgjC (C:)
    ppallrsvlfapgnradliaklprsapdavvidledavpgtaeakaaarpvahdaardli
    aaaphlavfvrvnalhspyfeddlsvltpelsgvvvpklemgaearqvaqmlqerslplp
    ilagletgagvwnareimevpevawayfgaedyttdlggkrtpgglevlyarsqvalaar
    ltgvaaldivvtalndpetfradaeqgralgysgklcihpaqvalaheyfg