PDB entry 1sgi

View 1sgi on RCSB PDB site
Description: Crystal structure of the anticoagulant slow form of thrombin
Class: hydrolase
Keywords: thrombin, allostery, HYDROLASE
Deposited on 2004-02-23, released 2004-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sgi.1
  • Chain 'B':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (71)
    Domains in SCOPe 2.08: d1sgi.1
  • Chain 'D':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sgi.2
  • Chain 'E':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (71)
    Domains in SCOPe 2.08: d1sgi.2
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sgiA (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgiA (A:)
    geadcglrplfekksledkterellesyidgr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sgiB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgiB (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
    kwiqkvidqfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sgiD (D:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgiD (D:)
    adcglrplfekksledkterellesyid
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sgiE (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sgiE (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketgqpsvlqvvnlpiverpvckdstriritdnmfc
    agykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlk
    kwiqkvidqf