PDB entry 1sgh

View 1sgh on RCSB PDB site
Description: Moesin FERM domain bound to EBP50 C-terminal peptide
Deposited on 2004-02-23, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.338
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sghA (A:)
    mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlk
    lnkkvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppe
    tavllasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehr
    gmlredavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sghA (A:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sghB (B:)
    cldfnislamakerahqkrsskrapqmdwskknelfsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sghB (B:)
    ldfnislamakerahqkrsskrapqmdwskknelfsnl