PDB entry 1sgh

View 1sgh on RCSB PDB site
Description: Moesin FERM domain bound to EBP50 C-terminal peptide
Class: structural protein
Keywords: FERM-peptide complex, STRUCTURAL PROTEIN
Deposited on 2004-02-23, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.338
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: moesin
    Species: Homo sapiens [TaxId:9606]
    Gene: MSN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sgha1, d1sgha2, d1sgha3
  • Chain 'B':
    Compound: Ezrin-radixin-moesin binding phosphoprotein 50
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sghb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sghA (A:)
    mpktisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlk
    lnkkvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppe
    tavllasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehr
    gmlredavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sghA (A:)
    tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
    kvtaqdvrkespllfkfrakfypedvseeliqditqrlfflqvkegilnddiycppetav
    llasyavqskygdfnkevhksgylagdkllpqrvleqhklnkdqweeriqvwheehrgml
    redavleylkiaqdlemygvnyfsiknkkgselwlgvdalglniyeqndrltpkigfpws
    eirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sghB (B:)
    cldfnislamakerahqkrsskrapqmdwskknelfsnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sghB (B:)
    ldfnislamakerahqkrsskrapqmdwskknelfsnl