PDB entry 1sgg

View 1sgg on RCSB PDB site
Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Deposited on 1999-01-08, released 1999-10-06
The last revision prior to the SCOP 1.65 freeze date was dated 1999-10-06, with a file datestamp of 1999-10-05.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1sgg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download) 
    >1sgg_ (-)
drtipdytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqk
kilnsiqvmraqmnq

    Sequence, based on observed residues (ATOM records): (download) 
    >1sgg_ (-)
ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
qvmraqm