PDB entry 1sgg

View 1sgg on RCSB PDB site
Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Deposited on 1999-01-08, released 1999-10-06
The last revision prior to the SCOP 1.57 freeze date was dated 1999-10-06, with a file datestamp of 1999-10-05.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1sgg__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sgg_ (-)
  ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
  qvmraqm