PDB entry 1sgg

View 1sgg on RCSB PDB site
Description: the solution structure of sam domain from the receptor tyrosine kinase ephb2, nmr, 10 structures
Class: tyrosine-protein kinase
Keywords: nmr, receptor oligomerization, eph receptors, tyrosine phosphorylation, signal transduction, tyrosine-protein kinase
Deposited on 1999-01-08, released 1999-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ephrin type-b receptor 2
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sgga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sggA (A:)
    drtipdytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqk
    kilnsiqvmraqmnq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sggA (A:)
    ytsfntvdewldaikmsqykesfasagfttfdivsqmtvedilrvgvtlaghqkkilnsi
    qvmraqm