PDB entry 1sg9

View 1sg9 on RCSB PDB site
Description: Crystal structure of Thermotoga maritima protein HEMK, an N5-glutamine methyltransferase
Class: unknown function
Keywords: structural genomics, protein structure initiative, HEMK protein, hypothetical protein, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, UNKNOWN FUNCTION
Deposited on 2004-02-23, released 2004-08-17
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.235
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sg9a_
  • Chain 'B':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sg9b_
  • Chain 'C':
    Compound: hemK protein
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1sg9c_
  • Heterogens: SAM, GLN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg9A (A:)
    mdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvsp
    teekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirky
    giktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgef
    lepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsg
    kivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg9A (A:)
    sgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekril
    elvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvad
    igtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkek
    fasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmei
    gedqveelkkivsdtvflkdsagkyrflllnrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg9B (B:)
    mdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvsp
    teekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirky
    giktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgef
    lepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsg
    kivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg9B (B:)
    sgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekril
    elvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvad
    igtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkek
    fasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmei
    gedqveelkkivsdtvflkdsagkyrflllnrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sg9C (C:)
    mdtrknvsgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvsp
    teekrilelvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirky
    giktvadigtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgef
    lepfkekfasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsg
    kivlmeigedqveelkkivsdtvflkdsagkyrflllnrrss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg9C (C:)
    sgaerkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekril
    elvekrasgyplhyilgekefmglsflveegvfvprpeteelvelalelirkygiktvad
    igtgsgaigvsvakfsdaivfatdvsskaveiarknaerhgvsdrffvrkgeflepfkek
    fasiemilsnppyvkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmei
    gedqveelkkivsdtvflkdsagkyrflllnrrs