PDB entry 1sg8

View 1sg8 on RCSB PDB site
Description: crystal structure of the procoagulant fast form of thrombin
Deposited on 2004-02-23, released 2004-06-08
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.219
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sg8.1
  • Chain 'B':
    Domains in SCOP 1.69: d1sg8.1
  • Chain 'D':
    Domains in SCOP 1.69: d1sg8.2
  • Chain 'E':
    Domains in SCOP 1.69: d1sg8.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg8A (A:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg8A (A:)
    adcglrplfekksledkterellesyi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg8B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg8B (B:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwgqpsvlqvvnlpiverpvckdstriritdnmf
    cagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrl
    kkwiqkvidqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sg8D (D:)
    tfgsgeadcglrplfekksledkterellesyidgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg8D (D:)
    adcglrplfekksledkterellesyi
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sg8E (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstrir
    itdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfy
    thvfrlkkwiqkvidqfge
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg8E (E:)
    ivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftendll
    vrigkhsrtryeaniekismlekiyihprynwrenldrdialmklkkpvafsdyihpvcl
    pdretaasllqagykgrvtgwgnlketwgqpsvlqvvnlpiverpvckdstriritdnmf
    cagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrl
    kkwiqkvidqf