PDB entry 1sg5

View 1sg5 on RCSB PDB site
Description: Solution structure of Yaeo, a Rho-specific inhibitor of transcription termination
Class: structural genomics, transcription, protein binding
Keywords: a+b protein, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2004-02-23, released 2005-07-12
The last revision prior to the SCOP 1.73 freeze date was dated 2007-08-28, with a file datestamp of 2007-08-24.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, hypothetical protein
    Species: Escherichia coli
    Gene: YaeO
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sg5A (A:)
msmndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaag
etrelrldkitsfshpeigtvvvses