PDB entry 1sg5

View 1sg5 on RCSB PDB site
Description: Solution structure of Yaeo, a Rho-specific inhibitor of transcription termination
Class: structural genomics, transcription, protein binding
Keywords: a+b protein, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics, TRANSCRIPTION, PROTEIN BINDING
Deposited on 2004-02-23, released 2005-07-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, hypothetical protein
    Species: Escherichia coli [TaxId:562]
    Gene: YaeO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AFW8 (2-85)
      • insertion (0-1)
    Domains in SCOPe 2.08: d1sg5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sg5A (A:)
    msmndtyqpincddydnlelacqhhlmltlelkdgeklqakasdlvsrknveylvveaag
    etrelrldkitsfshpeigtvvvses