PDB entry 1sg3

View 1sg3 on RCSB PDB site
Description: structure of allantoicase
Deposited on 2004-02-23, released 2004-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.2
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg3A (A:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptr
    fvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealyd
    egeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrl
    ygrvvppelktkdhiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsr
    qpghtdwaviqlgressfiekiivdtahfrgnfpqfitvegclkesessentgegtwvel
    vgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg3A (A:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwyd
    gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegnive
    ddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppii
    dlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgres
    sfiekiivdtahfrgnfpqfitvegclkgtwvelvgksktgpdkehvyeirksirvshvk
    ltiipdggvkrirvwgy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg3B (B:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdptr
    fvhsgawydgwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealyd
    egeegniveddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrl
    ygrvvppelktkdhiidlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsr
    qpghtdwaviqlgressfiekiivdtahfrgnfpqfitvegclkesessentgegtwvel
    vgksktgpdkehvyeirksirvshvkltiipdggvkrirvwgyhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg3B (B:)
    mkffsladeaefksiiisknkavdvigsklggqvvsfsdewfasaenliqptapirdwyd
    gwetrrhnemeydwviikmgvaaahiiggeidtaffngnhapfvsiealydegeegnive
    ddsrwveivekfecgpsqrhlfvrgngltkerfthiklkmypdggiarfrlygrvvppii
    dlayvcngavalkysdqhfgsvdnlllpgrghdmsdgwetkrsrqpghtdwaviqlgres
    sfiekiivdtahfrgnfpqfitvegclktwvelvgksktgpdkehvyeirksirvshvkl
    tiipdggvkrirvwgyh