PDB entry 1sg1

View 1sg1 on RCSB PDB site
Description: Crystal Structure of the Receptor-Ligand Complex between Nerve Growth Factor and the Common Neurotrophin Receptor p75
Class: hormone/growth factor/membrane protein
Keywords: Nerve Growth Factor, NGF, p75, Neurotrophin, common neurotrophin receptor, crystal structure, growth factor receptor, receptor/ligand complex
Deposited on 2004-02-22, released 2004-06-01
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-nerve growth factor
    Species: HOMO SAPIENS
    Gene: NGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg1a_
  • Chain 'B':
    Compound: Beta-nerve growth factor
    Species: HOMO SAPIENS
    Gene: NGFB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg1b_
  • Chain 'X':
    Compound: Tumor necrosis factor receptor superfamily member 16
    Species: Rattus norvegicus
    Gene: p75
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg1x1, d1sg1x2, d1sg1x3, d1sg1x4
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sg1A (A:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg1A (A:)
    efsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidskhw
    nsycttthtfvkaltmdgkqaawrfiridtacvcvlsrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sg1B (B:)
    ssshpifhrgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrd
    pnpvdsgcrgidskhwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrkavrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg1B (B:)
    rgefsvcdsvsvwvgdkttatdikgkevmvlgevninnsvfkqyffetkcrdgcrgidsk
    hwnsycttthtfvkaltmdgkqaawrfiridtacvcvlsrka
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1sg1X (X:)
    ketcstglythsgecckacnlgegvaqpcganqtvcepcldnvtfsdvvsatepckpcte
    clglqsmsapcveaddavcrcaygyyqdeetghceacsvcevgsglvfscqdkqntvcee
    cpegtysdeanhvdpclpctvcedterqlrectpwadaece
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sg1X (X:)
    etcstglythsgecckacnlgegvaqpcganqtvcepcldnvtfsdvvsatepckpctec
    lglqsmsapcveaddavcrcaygyyqdeetghceacsvcevgsglvfscqdkqntvceec
    pegtysdeanhvdpclpctvcedterqlrectpwadaece