PDB entry 1sg0

View 1sg0 on RCSB PDB site
Description: Crystal structure analysis of QR2 in complex with resveratrol
Class: oxidoreductase
Keywords: quinone reductase 2, resveratrol
Deposited on 2004-02-22, released 2005-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.214
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nrh dehydrogenase [quinone] 2
    Species: HOMO SAPIENS
    Gene: NQO2, NMOR2, BC006096
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg0a1
  • Chain 'B':
    Compound: nrh dehydrogenase [quinone] 2
    Species: HOMO SAPIENS
    Gene: NQO2, NMOR2, BC006096
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1sg0b1
  • Heterogens: ZN, FAD, STL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sg0A (A:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sg0B (B:)
    agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
    npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
    cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
    fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq