PDB entry 1sfy

View 1sfy on RCSB PDB site
Description: Crystal structure of recombinant Erythrina corallodandron Lectin
Class: sugar binding protein
Keywords: Legume lectin, glycosylation, Erythrina lectin
Deposited on 2004-02-21, released 2004-08-10
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.18
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfya_
  • Chain 'B':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfyb_
  • Chain 'C':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfyc_
  • Chain 'D':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfyd_
  • Chain 'E':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfye_
  • Chain 'F':
    Compound: lectin
    Species: ERYTHRINA CORALLODENDRON
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16404 (0-238)
      • see remark 999 (23)
      • see remark 999 (133)
      • see remark 999 (177)
    Domains in SCOP 1.73: d1sfyf_
  • Heterogens: LAT, MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyA (A:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyB (B:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyC (C:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyD (D:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyE (E:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfyF (F:)
    vetisfsfsefepgndnltlqgaslitqsgvlqltkinqngmpawdstgrtlyakpvhiw
    dmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdns
    yqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskllh
    avlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpe