PDB entry 1sfw

View 1sfw on RCSB PDB site
Description: porcine pancreas phospholipase a2, nmr, 18 structures
Class: hydrolase
Keywords: phospholipase a2, phosphatide-2-acyl-hydrolase
Deposited on 1996-02-23, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Sus scrofa [TaxId:9823]
    Gene: PORCINE PANCREAS PLA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfwa_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfwA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc