PDB entry 1sfu

View 1sfu on RCSB PDB site
Description: Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA
Deposited on 2004-02-20, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sfua_
  • Chain 'B':
    Domains in SCOP 1.69: d1sfub_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfuA (A:)
    mdllsctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvk
    mvpsnppkwfknync
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfuA (A:)
    ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
    ppkwfknync
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfuB (B:)
    mdllsctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvk
    mvpsnppkwfknync
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfuB (B:)
    ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
    ppkwfknync