PDB entry 1sfu

View 1sfu on RCSB PDB site
Description: Crystal structure of the viral Zalpha domain bound to left-handed Z-DNA
Class: DNA Binding Protein/DNA
Keywords: Protein/Z-DNA complex, DNA Binding Protein/DNA COMPLEX
Deposited on 2004-02-20, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 34L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfua_
  • Chain 'B':
    Compound: 34L protein
    Species: Yaba-like disease virus [TaxId:132475]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfub_
  • Chain 'C':
    Compound: 5'-d(*t*cp*gp*cp*gp*cp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*t*cp*gp*cp*gp*cp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfuA (A:)
    mdllsctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvk
    mvpsnppkwfknync
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfuA (A:)
    ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
    ppkwfknync
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfuB (B:)
    mdllsctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvk
    mvpsnppkwfknync
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfuB (B:)
    ctvndaeifslvkkevlslntndyttaislsnrlkinkkkinqqlyklqkedtvkmvpsn
    ppkwfknync
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.