PDB entry 1sft

View 1sft on RCSB PDB site
Description: alanine racemase
Deposited on 1996-09-20, released 1997-02-12
The last revision prior to the SCOP 1.65 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sftA (A:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigagessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sftA (A:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnaiga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sftB (B:)
    mndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagas
    rlavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysg
    pfpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsy
    qytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyp
    lkeafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvd
    gqkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpcti
    syrvpriffrhkrimevrnaigagessa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sftB (B:)
    ndfhrdtwaevdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasr
    lavafldealalrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgp
    fpihfhlkmdtgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyq
    ytrflhmlewlpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpypl
    keafslhsrlvhvkklqpgekvsygatytaqteewigtipigyadgwlrrlqhfhvlvdg
    qkapivgricmdqcmirlpgplpvgtkvtligrqgdevisiddvarhletinyevpctis
    yrvpriffrhkrimevrnai