PDB entry 1sfs

View 1sfs on RCSB PDB site
Description: 1.07 a crystal structure of an uncharacterized b. stearothermophilus protein
Deposited on 2004-02-20, released 2004-03-02
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-02, with a file datestamp of 2004-03-02.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: 0.102
AEROSPACI score: 0.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1sfsa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfsA (A:)
    mhhhhhhssgvdlgtenlyfqsnamargiwgvdsaqvvtdqlfqcvrtelgypkfwgryl
    sevpnvsegltrdeivrirnygvkvlpiynafreavgyangqvaarnavfharrlgipkn
    kllfaniedffavdaawiaawvetlyptgyrpglyadptkgdfaaayceavsrnnqvavq
    aviwsaaprpgttkeqkapryqpaappcsanvwvwqygrdaevcpvdtnladrrlldfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfsA (A:)
    giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp
    iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp
    tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp
    csanvwvwqygrdaevcpvdtnladrrlldfly