PDB entry 1sfs

View 1sfs on RCSB PDB site
Description: 1.07 A crystal structure of an uncharacterized B. stearothermophilus protein
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, unknown function, possible bacterial Lysozyme, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-02-20, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: RBSTP1166
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfsa_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfsA (A:)
    mhhhhhhssgvdlgtenlyfqsnamargiwgvdsaqvvtdqlfqcvrtelgypkfwgryl
    sevpnvsegltrdeivrirnygvkvlpiynafreavgyangqvaarnavfharrlgipkn
    kllfaniedffavdaawiaawvetlyptgyrpglyadptkgdfaaayceavsrnnqvavq
    aviwsaaprpgttkeqkapryqpaappcsanvwvwqygrdaevcpvdtnladrrlldfly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfsA (A:)
    giwgvdsaqvvtdqlfqcvrtelgypkfwgrylsevpnvsegltrdeivrirnygvkvlp
    iynafreavgyangqvaarnavfharrlgipknkllfaniedffavdaawiaawvetlyp
    tgyrpglyadptkgdfaaayceavsrnnqvavqaviwsaaprpgttkeqkapryqpaapp
    csanvwvwqygrdaevcpvdtnladrrlldfly