PDB entry 1sfr

View 1sfr on RCSB PDB site
Description: Crystal Structure of the Mycobacterium tuberculosis Antigen 85A Protein
Class: transferase
Keywords: alpha/beta hydrolase, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC, TRANSFERASE
Deposited on 2004-02-20, released 2004-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.222
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antigen 85-A
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfra_
  • Chain 'B':
    Compound: Antigen 85-A
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfrb_
  • Chain 'C':
    Compound: Antigen 85-A
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfrc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfrA (A:)
    afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
    wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
    savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
    wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
    fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpntgpapqgalghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfrA (A:)
    afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
    wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
    savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
    wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
    fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfrB (B:)
    afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
    wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
    savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
    wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
    fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpntgpapqgalghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfrB (B:)
    afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
    wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
    savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
    wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
    fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sfrC (C:)
    afsrpglpveylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafe
    wydqsglsvvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptg
    savvglsmaassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdm
    wgpkedpawqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnik
    fqdaynaggghngvfdfpdsgthsweywgaqlnamkpdlqralgatpntgpapqgalghh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfrC (C:)
    veylqvpspsmgrdikvqfqsgganspalylldglraqddfsgwdintpafewydqsgls
    vvmpvggqssfysdwyqpacgkagcqtykwetfltselpgwlqanrhvkptgsavvglsm
    aassaltlaiyhpqqfvyagamsglldpsqamgptliglamgdaggykasdmwgpkedpa
    wqrndpllnvgklianntrvwvycgngkpsdlggnnlpakflegfvrtsnikfqdaynag
    gghngvfdfpdsgthsweywgaqlnamkpdlqralgat