PDB entry 1sfp

View 1sfp on RCSB PDB site
Description: crystal structure of acidic seminal fluid protein (asfp) at 1.9 a resolution: a bovine polypeptide from the spermadhesin family
Class: spermadhesin
Keywords: spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, asfp, cub domain, x-ray crystal structure, growth factor
Deposited on 1997-06-24, released 1998-06-24
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: asfp
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29392 (Start-113)
  Domains in SCOPe 2.05: d1sfpa_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1sfpA (A:)
  mdwlprntncggilkeesgviatyygpktncvwtiqmppeyhvrvsiqylqlncnkesle
  iidglpgspvlgkicegslmdyrssgsimtvkyirepehpasfyevlyfqdpqa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1sfpA (A:)
  lprntncggilkeesgviatyygpktncvwtiqmppeyhvrvsiqylqlncnkesleiid
  glpgspvlgkicegslmdyrssgsimtvkyirepehpasfyevlyfqdpqa