PDB entry 1sfn

View 1sfn on RCSB PDB site
Description: Crystal structure of protein DR1152 from Deinococcus radiodurans R1, Pfam DUF861
Class: structural genomics, unknown function
Keywords: Structural genomics, NYSGXRC target T1583, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-02-20, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.46 Å
R-factor: 0.229
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfna_
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Deinococcus radiodurans [TaxId:1299]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfnA (A:)
    mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
    aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
    yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
    aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
    nrhplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfnA (A:)
    mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
    aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
    yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
    aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
    nrhpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfnB (B:)
    mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
    aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
    yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
    aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
    nrhplg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfnB (B:)
    mkhlgqtrsalhgshavitpetfvrtalaewpgsaivlhiapvvglgarfvqftaempag
    aqatesvyqrfafvlsgevdvavggetrtlreydyvylpagekhmltaktdarvsvfekp
    yqtvegvqapgvywgnerenpgypfegddhliarkllpdepafdfmvstmsfapgaslpy
    aevhymehgllmlegeglykleenyypvtagdiiwmgahcpqwygalgrnwskyllykdm
    nrhpl