PDB entry 1sfl

View 1sfl on RCSB PDB site
Description: 1.9A Crystal structure of Staphylococcus aureus type I 3-dehydroquinase, apo form
Class: lyase
Keywords: 3-dehydroquinase, enzyme turnover, shikimate pathway, 3-dehydroquinate, LYASE
Deposited on 2004-02-20, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Staphylococcus aureus [TaxId:282458]
    Gene: aroD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sfla_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Staphylococcus aureus [TaxId:282458]
    Gene: aroD
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NXI0 (Start-237)
      • conflict (14)
    Domains in SCOPe 2.08: d1sflb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sflA (A:)
    mthvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmq
    dsfkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriith
    lqqynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamst
    fsdtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sflA (A:)
    hvevvatitpqletliqkinhridaidvlelridqfenvtvdqvaemitklkdsfkllvt
    yrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqynkev
    iishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtmdck
    vvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sflB (B:)
    mthvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkvmq
    dsfkllvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriith
    lqqynkeviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamst
    fsdtmdckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sflB (B:)
    hvevvatitpqlsieetliqkinhridaidvlelridqfenvtvdqvaemitklkdsfkl
    lvtyrtklqggygqftndsylnlisdlaningidmidiewqadidiekhqriithlqqyn
    keviishhnfestppldelqfiffkmqkfnpeyvklavmphnkndvlnllqamstfsdtm
    dckvvgismsklglisrtaqgvfggaltygcigepqapgqidvtdlkaqvtly