PDB entry 1sfk

View 1sfk on RCSB PDB site
Description: Core (C) protein from West Nile Virus, subtype Kunjin
Deposited on 2004-02-19, released 2004-08-09
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-09, with a file datestamp of 2004-08-09.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.252
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sfka_
  • Chain 'B':
    Domains in SCOP 1.69: d1sfkb_
  • Chain 'C':
    Domains in SCOP 1.69: d1sfkc_
  • Chain 'D':
    Domains in SCOP 1.69: d1sfkd_
  • Chain 'E':
    Domains in SCOP 1.69: d1sfke_
  • Chain 'F':
    Domains in SCOP 1.69: d1sfkf_
  • Chain 'G':
    Domains in SCOP 1.69: d1sfkg_
  • Chain 'H':
    Domains in SCOP 1.69: d1sfkh_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfkA (A:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkA (A:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sfkB (B:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkB (B:)
    rgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsfkkelgtltsainr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sfkC (C:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkC (C:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sfkD (D:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkD (D:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1sfkE (E:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkE (E:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1sfkF (F:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkF (F:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1sfkG (G:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkG (G:)
    lsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsf
    kkelgtltsainr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1sfkH (H:)
    rvlsltglkramlslidgrgptrfvlallaffrftaiaptravldrwrsvnkqtamkhll
    sfkkelgtltsainrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfkH (H:)
    grgptrfvlallaffrftaiaptravldrwrsvnkqtamkhllsfkkelgtltsainr