PDB entry 1sfi

View 1sfi on RCSB PDB site
Description: High resolution structure of a potent, cyclic protease inhibitor from sunflower seeds
Class: hydrolase/hydrolase inhibitor
Keywords: TRYPSIN INHIBITOR, CYCLIC PEPTIDE, PROTEASE, BOVINE-TRYPSIN, SERINE PROTEASE-INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 1998-12-16, released 1999-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-09, with a file datestamp of 2016-11-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sfia_
  • Chain 'I':
    Compound: trypsin inhibitor 1
    Species: Helianthus annuus [TaxId:4232]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfiA (A:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    No sequence available.