PDB entry 1sff

View 1sff on RCSB PDB site
Description: Structure of gamma-aminobutyrate aminotransferase complex with aminooxyacetate
Class: transferase
Keywords: Enzyme complexes, AMINOTRANSFERASE
Deposited on 2004-02-19, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.159
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sffa_
  • Chain 'B':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sffb_
  • Chain 'C':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sffc_
  • Chain 'D':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sffd_
  • Heterogens: SO4, EDO, IK2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sffA (A:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sffA (A:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sffB (B:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sffB (B:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sffC (C:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sffC (C:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sffD (D:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sffD (D:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq