PDB entry 1sfe

View 1sfe on RCSB PDB site
Description: ada o6-methylguanine-DNA methyltransferase from escherichia coli
Class: DNA-binding protein
Keywords: enzyme, transferase, methyltransferase, nucleic acid binding protein, DNA repair protein, DNA-binding protein
Deposited on 1996-06-21, released 1996-12-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.219
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ada o6-methylguanine-DNA methyltransferase
    Species: Escherichia coli [TaxId:37762]
    Gene: ADAC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sfea1, d1sfea2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sfeA (A:)
    mtakqfrhggenlavryaladcelgrclvaesergicaillgdddatliselqqmfpaad
    napadlmfqqhvreviaslnqrdtpltlpldirgtafqqqvwqalrtipcgetvsyqqla
    naigkpkavravasacaanklaivipchrvvrgdgslsgyrwgvsrkaqllrreaeneer
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sfeA (A:)
    lavryaladcelgrclvaesergicaillgdddatliselqqmfpaadnapadlmfqqhv
    reviaslnqrdtpltlpldirgtafqqqvwqalrtipcgetvsyqqlanaigkpkavrav
    asacaanklaivipchrvvrgdgslsgyrwgvsrkaqllrreaen