PDB entry 1sfd

View 1sfd on RCSB PDB site
Description: oxidized form of amicyanin mutant P94F
Class: electron transport
Keywords: blue copper protein, beta sandwich, ELECTRON TRANSPORT
Deposited on 2004-02-19, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.119
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered (93)
    Domains in SCOPe 2.07: d1sfda_
  • Chain 'B':
    Compound: amicyanin
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: mauC, ami
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22364 (0-104)
      • engineered (93)
    Domains in SCOPe 2.07: d1sfdb_
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfdA (A:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sfdB (B:)
    dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
    vlgeaalkgpmmkkeqaysltfteagtydyhctfhpfmrgkvvve