PDB entry 1sf9

View 1sf9 on RCSB PDB site
Description: Crystal Structure of Bacillus subtilis YfhH Protein : Putative Transcriptional Regulator
Class: Structural Genomics, unknown function
Keywords: Structural Genomics, unknown function, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-02-19, released 2004-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.71 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yfhH hypothetical protein
    Species: Bacillus subtilis [TaxId:1423]
    Gene: yfhH
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31576 (24-127)
      • expression tag (10-23)
    Domains in SCOPe 2.08: d1sf9a1, d1sf9a2
  • Heterogens: PT, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sf9A (A:)
    mhhhhhhssgvdlgtenlyfqsnamekrysqmtphelnteiallsekarkaeqhgiinel
    avlerkitmakayllnpedyspgetyrventedeftisylngvfawgyrtsspqqeealp
    isvlqeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf9A (A:)
    vdlgtenlyfqsnamekrysqmtphelnteiallsekarkaeqhgiinelavlerkitma
    kayllnpedyspgetyrventedeftisylngvfawgyrtsspqqeealpisvlqeke