PDB entry 1sf5

View 1sf5 on RCSB PDB site
Description: Structure of oxidized state of the P94A mutant of amicyanin
Class: electron transport
Keywords: blue copper protein, beta sandwich, ELECTRON TRANSPORT
Deposited on 2004-02-19, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: 0.13
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: amicyanin
  Species: Paracoccus denitrificans [TaxId:266]
  Gene: mauC, ami
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22364 (0-104)
    • modified residue (50)
    • engineered (93)
  Domains in SCOPe 2.07: d1sf5a_
• Heterogens: CU, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1sf5A (A:)
  dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
  vlgeaalkgpmmkkeqaysltfteagtydyhctahpfmrgkvvve