PDB entry 1sf2

View 1sf2 on RCSB PDB site
Description: structure of e. coli gamma-aminobutyrate aminotransferase
Deposited on 2004-02-19, released 2004-09-14
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-14, with a file datestamp of 2004-09-14.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.165
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1sf2a_
  • Chain 'B':
    Domains in SCOP 1.69: d1sf2b_
  • Chain 'C':
    Domains in SCOP 1.69: d1sf2c_
  • Chain 'D':
    Domains in SCOP 1.69: d1sf2d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sf2A (A:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2A (A:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sf2B (B:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2B (B:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sf2C (C:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2C (C:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sf2D (D:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2D (D:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq