PDB entry 1sf2

View 1sf2 on RCSB PDB site
Description: Structure of E. coli gamma-aminobutyrate aminotransferase
Class: transferase
Keywords: aminotransferase, transferase
Deposited on 2004-02-19, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sf2a_
  • Chain 'B':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sf2b_
  • Chain 'C':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sf2c_
  • Chain 'D':
    Compound: 4-aminobutyrate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: GABT, B2662
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1sf2d_
  • Heterogens: SO4, PLP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sf2A (A:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2A (A:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sf2B (B:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2B (B:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1sf2C (C:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2C (C:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1sf2D (D:)
    mnsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhp
    kvvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavk
    iaraatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgise
    ddaiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliade
    vqsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyag
    npiacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielf
    edgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqc
    fdeakq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sf2D (D:)
    nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiavlntghlhpk
    vvaaveaqlkklshtcfqvlayepylelceimnqkvpgdfakktllvttgseavenavki
    araatkrsgtiafsgayhgrthytlaltgkvnpysagmglmpghvyralypcplhgised
    daiasihrifkndaapediaaiviepvqgeggfyasspafmqrlralcdehgimliadev
    qsgagrtgtlfameqmgvapdlttfaksiaggfplagvtgraevmdavapgglggtyagn
    piacvaalevlkvfeqenllqkandlgqklkdgllaiaekhpeigdvrglgamiaielfe
    dgdhnkpdakltaeivarardkglillscgpyynvlrilvpltiedaqirqgleiisqcf
    deakq