PDB entry 1sf0

View 1sf0 on RCSB PDB site
Description: backbone solution structure of mixed alpha/beta protein pf1061
Class: structural genomics, unknown function
Keywords: RESIDUAL DIPOLAR COUPLINGS, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, UNKNOWN FUNCTION
Deposited on 2004-02-19, released 2004-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PF1061
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: PF1061
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1sf0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1sf0A (A:)
ahhhhhhgskmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvledd
evkdgdfvevipvvsgg

    Sequence, based on observed residues (ATOM records): (download) 
    >1sf0A (A:)
kmikvkvigrniekeiewregmkvrdilravgfntesaiakvngkvvleddevkdgdfve
vipvvsgg