PDB entry 1sez

View 1sez on RCSB PDB site
Description: Crystal Structure of Protoporphyrinogen IX Oxidase
Class: oxidoreductase
Keywords: FAD-binding, Para-hydroxy-benzoate-hydroxylase fold (PHBH-fold), monotopic membrane-binding domain, OXIDOREDUCTASE
Deposited on 2004-02-19, released 2004-04-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protoporphyrinogen oxidase, mitochondrial
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: PPXII, PPOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24164
      • modified residue (68)
      • modified residue (129)
      • modified residue (185)
      • modified residue (241)
      • modified residue (301)
      • modified residue (311)
      • modified residue (375-376)
      • modified residue (455)
    Domains in SCOPe 2.05: d1seza1, d1seza2
  • Chain 'B':
    Compound: Protoporphyrinogen oxidase, mitochondrial
    Species: Nicotiana tabacum [TaxId:4097]
    Gene: PPXII, PPOX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O24164
      • modified residue (68)
      • modified residue (129)
      • modified residue (185)
      • modified residue (241)
      • modified residue (301)
      • modified residue (311)
      • modified residue (375-376)
      • modified residue (455)
    Domains in SCOPe 2.05: d1sezb1, d1sezb2
  • Heterogens: FAD, OMN, TON, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sezA (A:)
    mapsagedkhssakrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgl
    iwdegantmtesegdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksn
    flstgsklqmllepilwknkklsqvsdshesvsgffqrhfgkevvdylidpfvagtcggd
    pdslsmhhsfpelwnlekrfgsvilgairsklspknekkqgppktsankkrqrgsfsflg
    gmqtltdaickdlredelrlnsrvlelscsctedsaidswsiisasphkrqseeesfdav
    imtaplcdvksmkiakrgnpfllnfipevdyvplsvvittfkrenvkyplegfgvlvpsk
    eqqhglktlgtlfssmmfpdrapnnvylyttfvggsrnrelakasrtelkeivtsdlkql
    lgaegeptyvnhlywskafplyghnydsvldaidkmeknlpglfyagnhrgglsvgkals
    sgcnaadlvisylesvstdskrhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sezA (A:)
    akrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgliwdegantmtes
    egdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksnflstgsklqmll
    epilwshesvsgffqrhfgkevvdylidpfvagtcggdpdslsmhhsfpelwnlekrfgs
    vilgairsklsktsankkrqrgsfsflggmqtltdaickdlredelrlnsrvlelscsct
    edsaidswsiisasphkrqseeesfdavimtaplcdvksmkiakrgnpfllnfipevdyv
    plsvvittfkrenvkyplegfgvlvpskeqqhglktlgtlfssmmfpdrapnnvylyttf
    vggsrnrelakasrtelkeivtsdlkqllgaegeptyvnhlywskafplyghnydsvlda
    idkmeknlpglfyagnhrgglsvgkalssgcnaadlvisylesvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1sezB (B:)
    mapsagedkhssakrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgl
    iwdegantmtesegdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksn
    flstgsklqmllepilwknkklsqvsdshesvsgffqrhfgkevvdylidpfvagtcggd
    pdslsmhhsfpelwnlekrfgsvilgairsklspknekkqgppktsankkrqrgsfsflg
    gmqtltdaickdlredelrlnsrvlelscsctedsaidswsiisasphkrqseeesfdav
    imtaplcdvksmkiakrgnpfllnfipevdyvplsvvittfkrenvkyplegfgvlvpsk
    eqqhglktlgtlfssmmfpdrapnnvylyttfvggsrnrelakasrtelkeivtsdlkql
    lgaegeptyvnhlywskafplyghnydsvldaidkmeknlpglfyagnhrgglsvgkals
    sgcnaadlvisylesvstdskrhc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sezB (B:)
    akrvavigagvsglaaayklkihglnvtvfeaegkaggklrsvsqdgliwdegantmtes
    egdvtflidslglrekqqfplsqnkryiarngtpvllpsnpidliksnflstgsklqmll
    epilwshesvsgffqrhfgkevvdylidpfvagtcggdpdslsmhhsfpelwnlekrfgs
    vilgairsklsktsankkrqrgsfsflggmqtltdaickdlredelrlnsrvlelscsct
    edsaidswsiisasphkrqseeesfdavimtaplcdvksmkiakrgnpfllnfipevdyv
    plsvvittfkrenvkyplegfgvlvpskeqqhglktlgtlfssmmfpdrapnnvylyttf
    vggsrnrelakasrtelkeivtsdlkqllgaegeptyvnhlywskafplyghnydsvlda
    idkmeknlpglfyagnhrgglsvgkalssgcnaadlvisylesvs