PDB entry 1seq

View 1seq on RCSB PDB site
Description: Fab MNAC13
Class: immune system
Keywords: Immunoglobulin, IMMUNE SYSTEM
Deposited on 2004-02-18, released 2005-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal Antibody MNAC13
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1SEQ (0-End)
  • Chain 'L':
    Compound: Monoclonal Antibody MNAC13
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1SEQ (0-End)
    Domains in SCOPe 2.07: d1seql1, d1seql2
  • Heterogens: SO4, TRS, IPA, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1seqL (L:)
    divltqspaimsaslgssvtltcsasssvsymhwyqqksgtspvlliyttsnlasgvpsr
    fsgsgsgtfysltissveasdaadyychqwssypwtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypksinskwkidgserqngvlnswtdqdskdstysmsstltl
    tkneyerhnsytceathktstspivksfnrsec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1seqL (L:)
    divltqspaimsaslgssvtltcsasssvsymhwyqqksgtspvlliyttsnlasgvpsr
    fsgsgsgtfysltissveasdaadyychqwssypwtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypksinskwkidgserqngvlnswtdqdskdstysmsstltl
    tkneyerhnsytceathkspivksfnrs