PDB entry 1sep

View 1sep on RCSB PDB site
Description: mouse sepiapterin reductase complexed with nadp and sepiapterin
Class: oxidoreductase
Keywords: oxidoreductase, sepiapterin reductase, tetrahydrobiopterin
Deposited on 1997-05-23, released 1999-01-13
The last revision prior to the SCOP 1.75 freeze date was dated 1999-01-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sepiapterin reductase
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1sepa_
  • Heterogens: NAP, BIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1sepA (A:)
    meadglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqp
    dlkvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlae
    vnnywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardm
    lyqvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaq
    kllgllqkdtfqsgahvdfyd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1sepA (A:)
    adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
    kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
    nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
    qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
    lgllqkdtfqsgahvdfyd