PDB entry 1sep

View 1sep on RCSB PDB site
Description: mouse sepiapterin reductase complexed with nadp and sepiapterin
Deposited on 1997-05-23, released 1999-01-13
The last revision prior to the SCOP 1.55 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.174
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1sep__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1sep_ (-)
    adglgcavcvltgasrgfgralapqlarllspgsvmlvsarsesmlrqlkeelgaqqpdl
    kvvlaaadlgteagvqrllsavrelprpeglqrlllinnaatlgdvskgflnvndlaevn
    nywalnltsmlcltsgtlnafqdspglsktvvnisslcalqpykgwglycagkaardmly
    qvlaaeepsvrvlsyapgpldndmqqlaretskdpelrsklqklksdgalvdcgtsaqkl
    lgllqkdtfqsgahvdfyd